PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491455.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 294aa    MW: 32798.5 Da    PI: 8.6935
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491455.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer993.6e-3176131258
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     +++rY+eClkNhAas+Gg+++DGCgEfmp  geegt +alkCaAC+CHRnFHR+e++
  XP_016491455.1  76 SRARYRECLKNHAASIGGNVTDGCGEFMPC-GEEGTLEALKCAACNCHRNFHRKEQQ 131
                     5789*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.5E-2878130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2179129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-2979129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.39980129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.78E-16224284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-29225287IPR009057Homeodomain-like
TIGRFAMsTIGR015656.0E-28226283IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MALAGEDKEM RMQGSLGYHS LDQNLDQGNH HHHHHHQPNN NNLQPQQDHE KSSSGAAPVV  60
PYSSGGSTNN KFKITSRARY RECLKNHAAS IGGNVTDGCG EFMPCGEEGT LEALKCAACN  120
CHRNFHRKEQ QHVGADNNNN AGIMVVHPLQ LPQPLPSPLP SMNHHHQHGR SVWSTMPPQP  180
VKMAFRGSGG GGSGATDSSS EELNFNTYQQ ATSVPPQPQP PFVLAKKRFR TKFTQDQKEK  240
MLEFAEKLGW RIPREDDTEV QRFCSQVGVK RQVFKVWLHN NKNPSAKKNP QEEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-242272841875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491455.10.0PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9ZPW76e-61ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZWJ41e-120M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095811e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-58homeobox protein 33